- Welcome to TopFreeBiz.com:
- Join Now |
- Sign In |
- Contact Us
Hot Products
Enzyme Catalyst-D-Amino Acid Dehydrogenase
D-Amino acid dehydrogenase; For synthesis of D-amino acids; The biggest advantage of using enzymes in organic synthesis is their often unsurpassed selectivity. with enzymes, enantioselectivities of > 99% e. E. Can be achieved routinely in synthesizing chiral compound...
Chondroitin Sulfate Sodium
Chondroitin Sulfate ( C14H19NO14Sna2 )n Sodium chondroitin sulfate[24967-93-9] Chondroitin Sulfate Salium is the sodium salt of the sulfated linear glycosaminoglycan obtained from bovine, porcine, or avian cartilages of healthy and domestic animals used for food by human...
Benzocaine
Quality Standard: BP2003/USP27 Apperance: White crystalline powder Identification: Conformed Assay: 99.54% Melting point: 89centigrade to 91centigrade Clarification: Conformed Loss on drying: 0.27% Acidity: Conformed Chloride: Conformed Readily carbonizalbe substa...
N-Acetyl-Thiazolidine-4-Carboxylicacid (5025-82-1)
Folcisteine, which synonyms areN-Acetyl-L-Thioproline, N-Acetyl-Thiozolidine-4-Carboxylic acid, 3-Acetylthiazolidine-4-carboxylic acid, NATCA, AATC, etc., mainly used in agriculture, pharmaceutical. Item Standard Melting point 145deg~149deg Residue on ignition(sulfate...
Procaine HCl
White crystals or white crystaline powder, odourless, taste slight bitter and then turn to a benumbing sensation. Freely soluble in water, slight souble in ethanol and chlorefrom, almost insoluble in ethylether.
Chondroitin Sulfate Sodium Powder USP32
Chondroitin Sulfate (C14H19NO14Sna2 )n Sodium chondroitin sulfate[24967-93-9] Chondroitin Sulfate Salium is the sodium salt of the sulfated linear glycosaminoglycan obtained from bovine, porcine, or avian cartilages of healthy and domestic animals used for food by huma...
Lidocaine HCl
Lidocaine HCl/ Base Lidocaine-CAS: 137-58-6 Lidocaine HCl-CAS: 73-78-9 Appearance: White crystalline powder Solubility: Soluble in water Purity: 99.5%min Standard: Usp 29, BP2002 Usage: The local anesthetic, the anti-arrythmia medicine, uses in each anaesthesia and ...
30% Acrylamide/Bis Solution
500 ml, 30% acrylamide and bis-acrylamide solution, 29: 1
Olaquindox (MQCA) Elisa Test Kit
1. Brief Olaquindox as performance-promoting feed additive is widely used in growing Livestock, poultry, and aquaculture. Olaquindox lead to toxicity of mutagenic, teratogenic and carcinogenic on human and animal. The European Union prohibit the use of olaquindox in 1...
DL-Methionine Food Grade
CAS RN: 59-51-8 ITEM STANDARD RESULTS Description White, crystalline platelets or powder having a characteristic odor. Qualified Identification As per FCC IV...
Glucosamine Sulfate 2NaCL
Chitosan is a kind of natural cation alkali amylose, colorless, flavorless, no poison and side effects. It has strong action of absorbing moisture and keeping moisture. There are a lot of hydrophilic groups containing hydroxyl, and amino etc. It has good compatible, pe...
Hyaluronic Acid High Molecular Weight
Hyaluronic Acid (Sodium Hyaluronate) INCI name: Hyaluronic Acid EINECS No.: 232-678-0 CAS No.: 9004-61-9 ( Hyaluronic acid ) Molecular Formula: (C14H21N011)n H. S. Code: 3913900000 Product Description: Hyaluronic acid(HA) is a straight chain macromolecular mucop...
Mini-Protean Dbio Precast Gels
Long shelf life Mini-PROTEAN Dbio precast gels are an innovative PAGE system designed to provide Laemmli-like separation patterns using a standard Tris-glycine running buffer system. Features and Benefits: 12 month shelf life Electrophoresis run times in as short ...
Streptomycin 72% SP
Streptomycin 72% SP (Bio-fungicides effective on Bacteric and fungic disease on crops ) Common name: Streptomycin, ( Agri-strep, Chemform) Other name: Streptomycin sulfate CAS No.: 57-92-1 Molecular Formula: C21H39N7O12, C42H84N14O36S3 Physical & chemical charact...
SNAP-8
Argirelin Matrixyl Lipopeptide Tripeptide Palmitoyl Tripeptide Tripeptide-1(Copper Peptide) AHK PAL-AHK AHK-Cu Rigin(PAL-GQPR) Snap-8 Leuphasyl Melanostatin DM Vialox Syn-AKE Syn-Coll PAL-Lys-Val-DAB-OH PAL-Lys-Val-DAB-Thr-OH
Bio-Polishing Enzyme Acid Cellulase
Polishing enzyme Acid Cellulase(liquid) CAS No.: 9012-54-8 EINECS NO.: 232-734-4 Acid Cellulase is a kind of liquid cellulase by fermentation of non-pathogenic bacteria microbe. Application: It can be used for cellulose fabrics bio-polishing. Be applied to woven f...
Taurine
Taurine JP8/JP15 1)Specs: Pharm grade; Food & feed grade 2)Packing: In 25kg drum / 25kg carton Taurine can be added to dairy products, beverage, monosodium glutamate and bean products. Taurine can accelerate the differentiation and development of nerve cell, enhance i...
Niacinamide 98% pure
Established in 1993, Zhejiang University Sunny Nutrition Technology Co.,Ltd is a state-level high-tech manufacturer specialized in the field of animal health/nutrition products. It has three production bases separately know as Jiangshu Sel-Biochem Co.,Ltd, Xinjiang Tianfu Sunny ...
Nosiheptide 0.25%,0.5%,1%
Established in 1993, Zhejiang University Sunny Nutrition Technology Co.,Ltd is a state-level high-tech manufacturer specialized in the field of animal health/nutrition products. It has three production bases separately know as Jiangshu Sel-Biochem Co.,Ltd, Xinjiang Tianfu Sunny ...
Cysteamine HCL 20%
Established in 1993, Zhejiang University Sunny Nutrition Technology Co.,Ltd is a state-level high-tech manufacturer specialized in the field of animal health/nutrition products. It has three production bases separately know as Jiangshu Sel-Biochem Co.,Ltd, Xinjiang Tianfu Sunny ...
Primo Dbol Wini, Boldenlo...Testostero...Series Powder and Injection
Our finished products is 10 ml per vial: Test-PROPIONATE 100 100mg/ml Test-ENANTHATE 250 250mg/ml Test-CYPIONATE 250 250mg/ml TREN ACE 100 *100mg/ml DECA 250 250mg/ml PRIMO 100 100mg/ml MASTERON 150 *150mg/ml BOLD 250 250mg/ml TREN E 250 250mg/ml BI-TREN 175 75...
Used Cooking Oil
It is used for biodiesel production Free fatty acids: ...5 % Max M. I. U(Moisture anandd Impurities): ...3% max Iodine value: ...120 Density (kg/m3): ...920 Sulphur Content (mg/kg): ...16 Acid Value (mg KOH)/g): ...7.0 Phosphorus Content (mg/kg): ...15 Packin...
D-Tryptophan/Amino Acid
D-Tryptophan/Amino Acid CAS No.: 153-94-6 Molecular Formula: C11H12N2O2 Package: 25kg drum ITEMS SPECIFICATION RESULTS Appearance White or yellowish crystal and crystal powder Complis...
Chondroitin 95%
Our Chondroitin Sulfate adopts world advanced technology--- Cartilage-Enzymatic hydrolysis Producing Chondroitin Sulfate and Collagen. Our established high-tech industrial park of 240, 000 sqm., realizing pollution-free and zero emissions in the manufacturing process...
Caustic Soda Pearls
Formula: NaOH M. W.: 40.00 Appearance: White pearls. Specifications: NaOH: 99.0% min Na2CO3: 0.5% max NaCl: 0.15% max Fe2O3: 0.005% max Package: in 25 kg p. P. Wovened bags with PE liner.
Silymarin (Milk Thistle P. E.)
CAS: 22888-70-6; 65666-07-1 Molecular Formula: C25H22O10 Apearance: White Yellow Powder Specification: DAB10 UV80% Silybin&Isosilybin≥ 30%; HPLC50%Silybin30%; UV75%; UV70%; Function: 1. It has the functions of protecting liver cell membrane and improving the liver fun...
Rchlorotoxin (CTX)
Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR [Disulfide Bridges: 2-19, 5-28, 16-33, 20-35] Molecular Weight: 3996Da Description: Chlorotoxin is an inhibitor of Cl-channels in colonic epithelial cells and inhibits Cl- fluxes across glioma cell membranes. Sourc...
4-Benzyloxybenzyl Alcohol Resin (Wang Resin)
Wang resin is perhaps the most widely used of all resin for SPOS. As a standard support it can be used for the solid phase immobilization of acids and the phenols for SPOS. The ester linkage may be achieved, which has good stability to a variety of reaction conditions,...
Coenzyme Q10 Cosmetic Grade
Coenzyme Q10 98% oil soluble Cosmetic grade Product name: Coenzyme Q10 CAS Number: 303-98-0 Chemical Formula: C59H90O4 Molecular Weight: 863.3576 Chemical name: 2-(3, 7, 11, 15, 19, 23, 27, 31, 35, 39-decamethyl- 2, 6, 10, 14, 18, 22, 26, 30, 34, 38-tetr...
Used Cooking Oil
We have a lot of used cooking oil and want to export to the Europe. The legal company in the Europe can use this used cooking oil to abstract the Biodiesel. We are willing and have the strength of the company's long-term cooperation. We are a reliable company, welcome ...
Flexible Emergency Mask of Collagen
1. It's can enhance your skin more beauty. 2. Whitening Anti-Freckle, Moisture, Anti-Acne, Anti-wrinkle, Relaxation.
Alfalaval Related Dismountable Gasket Plate Heat Exchangers
Jiangyin Alafa Technology Co., Ltd. is located in the beautiful and prosperous region - Jiangyin City, Jiangsu Province, with many rivers and lakes. We are in the south of China with beautiful view, near Yangtze River Highway Bridge, Xicheng Highway, Huning Highway and Yan...
Thermostable Alpha-Amylase Boli (HS-300)
Boli HS-300 is a very robust Alpha-amylase with exceptional thermostability, ideal for medium-temperature cooking process in fuel ethanol production with the following benefits: Enhanced liquefaction efficacy Decreased formation of non-fermentable sugars Fits to var...
Sta No Zo Lol
We invest large fund and brains into R&D, developing new products and pioneering new technics, to meet the demand of the market. All the products from our plants are the fruit of out R&D department, reaching the advanced standard of domestic market, many of which reach the...
8-Bromo-7- (but-2-ynyl) -3-Methyl-1h-Purine-2, 6 (3H, 7H) -Dione CAS: 666816-98-4
Chemical Name: 8-bromo-7-(but-2-ynyl)-3-methyl-1H-purine-2, 6(3H, 7H)-dione CAS: 666816-98-4 CBNumbe: CB22538943 Molecular Formula: C10H9BrN4O2 Formula Weight: 297 Purity: >97% Mol File: 666816-98-4. Mol Application Fields: Medical field, Pharmaceutical Intermed...
Yohimbine hydrochloride
Yohimbine hydrochlorideCAS Number: 65-19-0Assay:99%Molecular Formula: C21H27ClN2O3Molecular Weight: 390.9Packing:100g/foil bagEINECS: 200-600-4Appearance: White crystalline powderUses: Yohimbine hydrochloride is used in the treatment of male impotence.
Clomiphene Citrate
Clomiphene CitrateCAS Number: 50-41-9Assay:99%Molecular Formula: C32H36ClNO8Molecular Weight: 598.08Packing:100g/foil bagEINECS: 200-035-3Appearance:white powderUses: Pharmaceutical Raw Materials
Used Cooking Oil
Product Name: Used Cooking Oil Specification: Items index Typical value Free fatty acids 1.50 %Max M. I. U (Moisture and Impurities) 1.00 % Max. Saponification value 186 Iodine value 120 Titre C (melting point): 13.75" C Density (kg/m3) 920 Flashp...
Industry Grade Hydroxypropyl Methyl Cellulose
Products without surface treatment have infusibility in hot water, It can be wet in hot water 85 or above, but to make it totally dissolved, the solution must be cooled to 20-25to get ideal transparency and viscosity; Otherwise, if it is added in cold water without tot...
Glucoamylase Boli (HGA-100)
Boli HGA-100 dose not contain Glucosidase, thus enables high conversion rate from starch to sugar. Use of this product in grain processing leads to: Considerably reduced saccharifying time and processing costs; Significantly enhanced saccharification efficacy; Po...
